Protein Description: cadherin 8
Gene Name: CDH8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036510: 96%, ENSRNOG00000056643: 96%
Entrez Gene ID: 1006
Uniprot ID: P55286
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDH8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036510: 96%, ENSRNOG00000056643: 96%
Entrez Gene ID: 1006
Uniprot ID: P55286
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KDDPKNGHYFLYSLLPEMVNNPNFTIKKNEDNSLSILAKHNGFNRQKQEVYLLPIII |
| Documents & Links for Anti CDH8 pAb (ATL-HPA076441) | |
| Datasheet | Anti CDH8 pAb (ATL-HPA076441) Datasheet (External Link) |
| Vendor Page | Anti CDH8 pAb (ATL-HPA076441) at Atlas |
| Documents & Links for Anti CDH8 pAb (ATL-HPA076441) | |
| Datasheet | Anti CDH8 pAb (ATL-HPA076441) Datasheet (External Link) |
| Vendor Page | Anti CDH8 pAb (ATL-HPA076441) |