Anti CDH5 pAb (ATL-HPA075875)

Atlas Antibodies

Catalog No: ATL-HPA075875-100

• 
• 

Product Description

Protein Description: cadherin 5
Gene Name: CDH5
Alternative Gene Name: 7B4, CD144
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031871: 69%, ENSRNOG00000013324: 72%
Entrez Gene ID: 1003
Uniprot ID: P33151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETP
• Gene Sequence: SLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETP
• Gene ID - Mouse: ENSMUSG00000031871
• Gene ID - Rat: ENSRNOG00000013324
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.