![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101530/181655/atl-hpa075875_anti-cdh5-pab-atl-hpa075875_63323__61917.1681138031.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: cadherin 5
Gene Name: CDH5
Alternative Gene Name: 7B4, CD144
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031871: 69%, ENSRNOG00000013324: 72%
Entrez Gene ID: 1003
Uniprot ID: P33151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDH5
Alternative Gene Name: 7B4, CD144
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031871: 69%, ENSRNOG00000013324: 72%
Entrez Gene ID: 1003
Uniprot ID: P33151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETP |
| Documents & Links for Anti CDH5 pAb (ATL-HPA075875) | |
| Datasheet | Anti CDH5 pAb (ATL-HPA075875) Datasheet (External Link) |
| Vendor Page | Anti CDH5 pAb (ATL-HPA075875) at Atlas |
| Documents & Links for Anti CDH5 pAb (ATL-HPA075875) | |
| Datasheet | Anti CDH5 pAb (ATL-HPA075875) Datasheet (External Link) |
| Vendor Page | Anti CDH5 pAb (ATL-HPA075875) |