Protein Description: cadherin 20, type 2
Gene Name: CDH20
Alternative Gene Name: Cdh7, CDH7L3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050840: 97%, ENSRNOG00000014556: 97%
Entrez Gene ID: 28316
Uniprot ID: Q9HBT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDH20
Alternative Gene Name: Cdh7, CDH7L3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050840: 97%, ENSRNOG00000014556: 97%
Entrez Gene ID: 28316
Uniprot ID: Q9HBT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PFQDTTTVHISVEDVDEPPVFEPGFYFVEVPEDVAIGTTIQIISAKDPDVTNNSIRYSIDRSSDPGRFFYVDITTGALMTARPLDREEFSWHNITVLAMEMNNPSQVGSVPVTIKV |
| Documents & Links for Anti CDH20 pAb (ATL-HPA015490) | |
| Datasheet | Anti CDH20 pAb (ATL-HPA015490) Datasheet (External Link) |
| Vendor Page | Anti CDH20 pAb (ATL-HPA015490) at Atlas |
| Documents & Links for Anti CDH20 pAb (ATL-HPA015490) | |
| Datasheet | Anti CDH20 pAb (ATL-HPA015490) Datasheet (External Link) |
| Vendor Page | Anti CDH20 pAb (ATL-HPA015490) |