Protein Description: cadherin 15, type 1, M-cadherin (myotubule)
Gene Name: CDH15
Alternative Gene Name: CDH14, CDH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031962: 80%, ENSRNOG00000027954: 79%
Entrez Gene ID: 1013
Uniprot ID: P55291
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDH15
Alternative Gene Name: CDH14, CDH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031962: 80%, ENSRNOG00000027954: 79%
Entrez Gene ID: 1013
Uniprot ID: P55291
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LSIVKALDYESCEHYELKVSVQNEAPLQAAALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVAT |
| Documents & Links for Anti CDH15 pAb (ATL-HPA070961) | |
| Datasheet | Anti CDH15 pAb (ATL-HPA070961) Datasheet (External Link) |
| Vendor Page | Anti CDH15 pAb (ATL-HPA070961) at Atlas |
| Documents & Links for Anti CDH15 pAb (ATL-HPA070961) | |
| Datasheet | Anti CDH15 pAb (ATL-HPA070961) Datasheet (External Link) |
| Vendor Page | Anti CDH15 pAb (ATL-HPA070961) |