![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101333/181422/atl-hpa074623_anti-cdca7l-pab-atl-hpa074623_63090__37127.1681137745.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: cell division cycle associated 7 like
Gene Name: CDCA7L
Alternative Gene Name: JPO2, R1, RAM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021175: 78%, ENSRNOG00000005410: 79%
Entrez Gene ID: 55536
Uniprot ID: Q96GN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDCA7L
Alternative Gene Name: JPO2, R1, RAM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021175: 78%, ENSRNOG00000005410: 79%
Entrez Gene ID: 55536
Uniprot ID: Q96GN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MELATRYQIPKEVADIFNAPSDDEEFVGFRDDVPMETLSSEESCDSFDSLESGKQQDV |
| Documents & Links for Anti CDCA7L pAb (ATL-HPA074623) | |
| Datasheet | Anti CDCA7L pAb (ATL-HPA074623) Datasheet (External Link) |
| Vendor Page | Anti CDCA7L pAb (ATL-HPA074623) at Atlas |
| Documents & Links for Anti CDCA7L pAb (ATL-HPA074623) | |
| Datasheet | Anti CDCA7L pAb (ATL-HPA074623) Datasheet (External Link) |
| Vendor Page | Anti CDCA7L pAb (ATL-HPA074623) |