Description
Product Description
Protein Description: cell division cycle associated 7 like
Gene Name: CDCA7L
Alternative Gene Name: JPO2, R1, RAM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021175: 78%, ENSRNOG00000005410: 79%
Entrez Gene ID: 55536
Uniprot ID: Q96GN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDCA7L
Alternative Gene Name: JPO2, R1, RAM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021175: 78%, ENSRNOG00000005410: 79%
Entrez Gene ID: 55536
Uniprot ID: Q96GN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MELATRYQIPKEVADIFNAPSDDEEFVGFRDDVPMETLSSEESCDSFDSLESGKQQDV |
Gene Sequence | MELATRYQIPKEVADIFNAPSDDEEFVGFRDDVPMETLSSEESCDSFDSLESGKQQDV |
Gene ID - Mouse | ENSMUSG00000021175 |
Gene ID - Rat | ENSRNOG00000005410 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CDCA7L pAb (ATL-HPA074623) | |
Datasheet | Anti CDCA7L pAb (ATL-HPA074623) Datasheet (External Link) |
Vendor Page | Anti CDCA7L pAb (ATL-HPA074623) at Atlas Antibodies |
Documents & Links for Anti CDCA7L pAb (ATL-HPA074623) | |
Datasheet | Anti CDCA7L pAb (ATL-HPA074623) Datasheet (External Link) |
Vendor Page | Anti CDCA7L pAb (ATL-HPA074623) |