Protein Description: cell division cycle associated 4
Gene Name: CDCA4
Alternative Gene Name: FLJ20764, Hepp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047832: 78%, ENSRNOG00000013898: 72%
Entrez Gene ID: 55038
Uniprot ID: Q9BXL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDCA4
Alternative Gene Name: FLJ20764, Hepp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047832: 78%, ENSRNOG00000013898: 72%
Entrez Gene ID: 55038
Uniprot ID: Q9BXL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VDSPYYDLDTVLTGMMGGARPGPCEGLEGLAPATPGPSSSCKSDLGELDHVVEILVET |
Documents & Links for Anti CDCA4 pAb (ATL-HPA064971) | |
Datasheet | Anti CDCA4 pAb (ATL-HPA064971) Datasheet (External Link) |
Vendor Page | Anti CDCA4 pAb (ATL-HPA064971) at Atlas |
Documents & Links for Anti CDCA4 pAb (ATL-HPA064971) | |
Datasheet | Anti CDCA4 pAb (ATL-HPA064971) Datasheet (External Link) |
Vendor Page | Anti CDCA4 pAb (ATL-HPA064971) |