Anti CDC6 pAb (ATL-HPA065070)

Atlas Antibodies

Catalog No: ATL-HPA065070-25

• 

Product Description

Protein Description: cell division cycle 6
Gene Name: CDC6
Alternative Gene Name: CDC18L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017499: 87%, ENSRNOG00000027787: 85%
Entrez Gene ID: 990
Uniprot ID: Q99741
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLNQVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSPSEPLIPKRVGLIHISQVISEVDGNRM
• Gene Sequence: RLNQVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSPSEPLIPKRVGLIHISQVISEVDGNRM
• Gene ID - Mouse: ENSMUSG00000017499
• Gene ID - Rat: ENSRNOG00000027787
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.