Protein Description: cell division cycle 6
Gene Name: CDC6
Alternative Gene Name: CDC18L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017499: 87%, ENSRNOG00000027787: 85%
Entrez Gene ID: 990
Uniprot ID: Q99741
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDC6
Alternative Gene Name: CDC18L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017499: 87%, ENSRNOG00000027787: 85%
Entrez Gene ID: 990
Uniprot ID: Q99741
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RLNQVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSPSEPLIPKRVGLIHISQVISEVDGNRM |
| Documents & Links for Anti CDC6 pAb (ATL-HPA065070) | |
| Datasheet | Anti CDC6 pAb (ATL-HPA065070) Datasheet (External Link) |
| Vendor Page | Anti CDC6 pAb (ATL-HPA065070) at Atlas |
| Documents & Links for Anti CDC6 pAb (ATL-HPA065070) | |
| Datasheet | Anti CDC6 pAb (ATL-HPA065070) Datasheet (External Link) |
| Vendor Page | Anti CDC6 pAb (ATL-HPA065070) |