Protein Description: CDC42 effector protein 1
Gene Name: CDC42EP1
Alternative Gene Name: Borg5, CEP1, MSE55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049521: 61%, ENSRNOG00000008517: 68%
Entrez Gene ID: 11135
Uniprot ID: Q00587
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDC42EP1
Alternative Gene Name: Borg5, CEP1, MSE55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049521: 61%, ENSRNOG00000008517: 68%
Entrez Gene ID: 11135
Uniprot ID: Q00587
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV |
Gene ID - Mouse | ENSMUSG00000049521 |
Gene ID - Rat | ENSMUSG00000049521 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDC42EP1 pAb (ATL-HPA076536) | |
Datasheet | Anti CDC42EP1 pAb (ATL-HPA076536) Datasheet (External Link) |
Vendor Page | Anti CDC42EP1 pAb (ATL-HPA076536) at Atlas |
Documents & Links for Anti CDC42EP1 pAb (ATL-HPA076536) | |
Datasheet | Anti CDC42EP1 pAb (ATL-HPA076536) Datasheet (External Link) |
Vendor Page | Anti CDC42EP1 pAb (ATL-HPA076536) |