Protein Description: CDC42 effector protein 1
Gene Name: CDC42EP1
Alternative Gene Name: Borg5, CEP1, MSE55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049521: 61%, ENSRNOG00000008517: 68%
Entrez Gene ID: 11135
Uniprot ID: Q00587
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDC42EP1
Alternative Gene Name: Borg5, CEP1, MSE55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049521: 61%, ENSRNOG00000008517: 68%
Entrez Gene ID: 11135
Uniprot ID: Q00587
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV |
| Documents & Links for Anti CDC42EP1 pAb (ATL-HPA076536) | |
| Datasheet | Anti CDC42EP1 pAb (ATL-HPA076536) Datasheet (External Link) |
| Vendor Page | Anti CDC42EP1 pAb (ATL-HPA076536) at Atlas |
| Documents & Links for Anti CDC42EP1 pAb (ATL-HPA076536) | |
| Datasheet | Anti CDC42EP1 pAb (ATL-HPA076536) Datasheet (External Link) |
| Vendor Page | Anti CDC42EP1 pAb (ATL-HPA076536) |