Protein Description: CDC42 binding protein kinase alpha (DMPK-like)
Gene Name: CDC42BPA
Alternative Gene Name: FLJ23347, KIAA0451, MRCK, MRCKA, PK428
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026490: 90%, ENSRNOG00000002841: 90%
Entrez Gene ID: 8476
Uniprot ID: Q5VT25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDC42BPA
Alternative Gene Name: FLJ23347, KIAA0451, MRCK, MRCKA, PK428
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026490: 90%, ENSRNOG00000002841: 90%
Entrez Gene ID: 8476
Uniprot ID: Q5VT25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKD |
Documents & Links for Anti CDC42BPA pAb (ATL-HPA071252) | |
Datasheet | Anti CDC42BPA pAb (ATL-HPA071252) Datasheet (External Link) |
Vendor Page | Anti CDC42BPA pAb (ATL-HPA071252) at Atlas |
Documents & Links for Anti CDC42BPA pAb (ATL-HPA071252) | |
Datasheet | Anti CDC42BPA pAb (ATL-HPA071252) Datasheet (External Link) |
Vendor Page | Anti CDC42BPA pAb (ATL-HPA071252) |