Anti CDC42BPA pAb (ATL-HPA071252)

Atlas Antibodies

Catalog No: ATL-HPA071252-25

• 
• 

Product Description

Protein Description: CDC42 binding protein kinase alpha (DMPK-like)
Gene Name: CDC42BPA
Alternative Gene Name: FLJ23347, KIAA0451, MRCK, MRCKA, PK428
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026490: 90%, ENSRNOG00000002841: 90%
Entrez Gene ID: 8476
Uniprot ID: Q5VT25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKD
• Gene Sequence: TRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKD
• Gene ID - Mouse: ENSMUSG00000026490
• Gene ID - Rat: ENSRNOG00000002841
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.