Anti CDC25C pAb (ATL-HPA066991)

Atlas Antibodies

Catalog No: ATL-HPA066991-25

• 

Product Description

Protein Description: cell division cycle 25C
Gene Name: CDC25C
Alternative Gene Name: CDC25, PPP1R60
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044201: 67%, ENSRNOG00000024008: 64%
Entrez Gene ID: 995
Uniprot ID: P30307
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQL
• Gene Sequence: MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQL
• Gene ID - Mouse: ENSMUSG00000044201
• Gene ID - Rat: ENSRNOG00000024008
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.