Protein Description: cell division cycle 25C
Gene Name: CDC25C
Alternative Gene Name: CDC25, PPP1R60
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044201: 67%, ENSRNOG00000024008: 64%
Entrez Gene ID: 995
Uniprot ID: P30307
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDC25C
Alternative Gene Name: CDC25, PPP1R60
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044201: 67%, ENSRNOG00000024008: 64%
Entrez Gene ID: 995
Uniprot ID: P30307
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQL |
Documents & Links for Anti CDC25C pAb (ATL-HPA066991) | |
Datasheet | Anti CDC25C pAb (ATL-HPA066991) Datasheet (External Link) |
Vendor Page | Anti CDC25C pAb (ATL-HPA066991) at Atlas |
Documents & Links for Anti CDC25C pAb (ATL-HPA066991) | |
Datasheet | Anti CDC25C pAb (ATL-HPA066991) Datasheet (External Link) |
Vendor Page | Anti CDC25C pAb (ATL-HPA066991) |