Protein Description: CD96 molecule
Gene Name: CD96
Alternative Gene Name: TACTILE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022657: 54%, ENSRNOG00000023030: 56%
Entrez Gene ID: 10225
Uniprot ID: P40200
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CD96
Alternative Gene Name: TACTILE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022657: 54%, ENSRNOG00000023030: 56%
Entrez Gene ID: 10225
Uniprot ID: P40200
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VPGNKVWNISSEKITFLLGSEISSTDPPLSVTESTLDTQPSPASSVSPARYPATSSVTLVDVSALRPNTTPQPSNSSMTT |
| Documents & Links for Anti CD96 pAb (ATL-HPA066754 w/enhanced validation) | |
| Datasheet | Anti CD96 pAb (ATL-HPA066754 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD96 pAb (ATL-HPA066754 w/enhanced validation) at Atlas |
| Documents & Links for Anti CD96 pAb (ATL-HPA066754 w/enhanced validation) | |
| Datasheet | Anti CD96 pAb (ATL-HPA066754 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD96 pAb (ATL-HPA066754 w/enhanced validation) |