Description
Product Description
Protein Description: CD84 molecule
Gene Name: CD84
Alternative Gene Name: hCD84, mCD84, SLAMF5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038147: 54%, ENSRNOG00000022884: 51%
Entrez Gene ID: 8832
Uniprot ID: Q9UIB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CD84
Alternative Gene Name: hCD84, mCD84, SLAMF5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038147: 54%, ENSRNOG00000022884: 51%
Entrez Gene ID: 8832
Uniprot ID: Q9UIB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRL |
Gene Sequence | VTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRL |
Gene ID - Mouse | ENSMUSG00000038147 |
Gene ID - Rat | ENSRNOG00000022884 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CD84 pAb (ATL-HPA068020) | |
Datasheet | Anti CD84 pAb (ATL-HPA068020) Datasheet (External Link) |
Vendor Page | Anti CD84 pAb (ATL-HPA068020) at Atlas Antibodies |
Documents & Links for Anti CD84 pAb (ATL-HPA068020) | |
Datasheet | Anti CD84 pAb (ATL-HPA068020) Datasheet (External Link) |
Vendor Page | Anti CD84 pAb (ATL-HPA068020) |