Protein Description: CD79b molecule
Gene Name: CD79B
Alternative Gene Name: B29, IGB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040592: 57%, ENSRNOG00000011917: 56%
Entrez Gene ID: 974
Uniprot ID: P40259
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CD79B
Alternative Gene Name: B29, IGB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040592: 57%, ENSRNOG00000011917: 56%
Entrez Gene ID: 974
Uniprot ID: P40259
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDG |
Gene Sequence | RNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDG |
Gene ID - Mouse | ENSMUSG00000040592 |
Gene ID - Rat | ENSRNOG00000011917 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CD79B pAb (ATL-HPA044107 w/enhanced validation) | |
Datasheet | Anti CD79B pAb (ATL-HPA044107 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CD79B pAb (ATL-HPA044107 w/enhanced validation) at Atlas |
Documents & Links for Anti CD79B pAb (ATL-HPA044107 w/enhanced validation) | |
Datasheet | Anti CD79B pAb (ATL-HPA044107 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CD79B pAb (ATL-HPA044107 w/enhanced validation) |