Protein Description: CD40 ligand
Gene Name: CD40LG
Alternative Gene Name: CD154, CD40L, gp39, hCD40L, HIGM1, IMD3, TNFSF5, TRAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031132: 76%, ENSRNOG00000000871: 74%
Entrez Gene ID: 959
Uniprot ID: P29965
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CD40LG
Alternative Gene Name: CD154, CD40L, gp39, hCD40L, HIGM1, IMD3, TNFSF5, TRAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031132: 76%, ENSRNOG00000000871: 74%
Entrez Gene ID: 959
Uniprot ID: P29965
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQL |
| Documents & Links for Anti CD40LG pAb (ATL-HPA072480 w/enhanced validation) | |
| Datasheet | Anti CD40LG pAb (ATL-HPA072480 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD40LG pAb (ATL-HPA072480 w/enhanced validation) at Atlas |
| Documents & Links for Anti CD40LG pAb (ATL-HPA072480 w/enhanced validation) | |
| Datasheet | Anti CD40LG pAb (ATL-HPA072480 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD40LG pAb (ATL-HPA072480 w/enhanced validation) |