Protein Description: CD33 molecule
Gene Name: CD33
Alternative Gene Name: FLJ00391, p67, SIGLEC-3, SIGLEC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030474: 36%, ENSRNOG00000037339: 35%
Entrez Gene ID: 945
Uniprot ID: P20138
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CD33
Alternative Gene Name: FLJ00391, p67, SIGLEC-3, SIGLEC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030474: 36%, ENSRNOG00000037339: 35%
Entrez Gene ID: 945
Uniprot ID: P20138
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ |
| Documents & Links for Anti CD33 pAb (ATL-HPA035832) | |
| Datasheet | Anti CD33 pAb (ATL-HPA035832) Datasheet (External Link) |
| Vendor Page | Anti CD33 pAb (ATL-HPA035832) at Atlas |
| Documents & Links for Anti CD33 pAb (ATL-HPA035832) | |
| Datasheet | Anti CD33 pAb (ATL-HPA035832) Datasheet (External Link) |
| Vendor Page | Anti CD33 pAb (ATL-HPA035832) |
| Citations for Anti CD33 pAb (ATL-HPA035832) – 1 Found |
| Yang, Bao; Yang, Chenlong; Fang, Jingyi; Yang, Jun; Xu, Yulun. Clinicoradiological characteristics, management and prognosis of primary myeloid sarcoma of the central nervous system: A report of four cases. Oncology Letters. 2017;14(3):3825-3831. PubMed |