Protein Description: CD226 molecule
Gene Name: CD226
Alternative Gene Name: DNAM-1, DNAM1, PTA1, TLiSA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034028: 51%, ENSRNOG00000038197: 50%
Entrez Gene ID: 10666
Uniprot ID: Q15762
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CD226
Alternative Gene Name: DNAM-1, DNAM1, PTA1, TLiSA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034028: 51%, ENSRNOG00000038197: 50%
Entrez Gene ID: 10666
Uniprot ID: Q15762
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTL |
Documents & Links for Anti CD226 pAb (ATL-HPA015715) | |
Datasheet | Anti CD226 pAb (ATL-HPA015715) Datasheet (External Link) |
Vendor Page | Anti CD226 pAb (ATL-HPA015715) at Atlas |
Documents & Links for Anti CD226 pAb (ATL-HPA015715) | |
Datasheet | Anti CD226 pAb (ATL-HPA015715) Datasheet (External Link) |
Vendor Page | Anti CD226 pAb (ATL-HPA015715) |