Description
Product Description
Protein Description: CD1e molecule
Gene Name: CD1E
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028076: 42%, ENSRNOG00000016451: 41%
Entrez Gene ID: 913
Uniprot ID: P15812
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CD1E
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028076: 42%, ENSRNOG00000016451: 41%
Entrez Gene ID: 913
Uniprot ID: P15812
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PWSHGNFSKQELKNLQSLFQLYFHSFIRIVQASAGQFQLEYPFEIQILAGCRMNAPQIFLNMAYQGSDF |
Gene Sequence | PWSHGNFSKQELKNLQSLFQLYFHSFIRIVQASAGQFQLEYPFEIQILAGCRMNAPQIFLNMAYQGSDF |
Gene ID - Mouse | ENSMUSG00000028076 |
Gene ID - Rat | ENSRNOG00000016451 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CD1E pAb (ATL-HPA057769) | |
Datasheet | Anti CD1E pAb (ATL-HPA057769) Datasheet (External Link) |
Vendor Page | Anti CD1E pAb (ATL-HPA057769) at Atlas Antibodies |
Documents & Links for Anti CD1E pAb (ATL-HPA057769) | |
Datasheet | Anti CD1E pAb (ATL-HPA057769) Datasheet (External Link) |
Vendor Page | Anti CD1E pAb (ATL-HPA057769) |