Protein Description: CD1d molecule
Gene Name: CD1D
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028076: 60%, ENSRNOG00000016451: 62%
Entrez Gene ID: 912
Uniprot ID: P15813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CD1D
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028076: 60%, ENSRNOG00000016451: 62%
Entrez Gene ID: 912
Uniprot ID: P15813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPW |
| Documents & Links for Anti CD1D pAb (ATL-HPA072662) | |
| Datasheet | Anti CD1D pAb (ATL-HPA072662) Datasheet (External Link) |
| Vendor Page | Anti CD1D pAb (ATL-HPA072662) at Atlas |
| Documents & Links for Anti CD1D pAb (ATL-HPA072662) | |
| Datasheet | Anti CD1D pAb (ATL-HPA072662) Datasheet (External Link) |
| Vendor Page | Anti CD1D pAb (ATL-HPA072662) |