Protein Description: CD177 molecule
Gene Name: CD177
Alternative Gene Name: HNA2A, NB1, PRV1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052212: 49%, ENSRNOG00000022669: 46%
Entrez Gene ID: 57126
Uniprot ID: Q8N6Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CD177
Alternative Gene Name: HNA2A, NB1, PRV1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052212: 49%, ENSRNOG00000022669: 46%
Entrez Gene ID: 57126
Uniprot ID: Q8N6Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GATHCYDGYIHLSGGGLTTRMSIQGCVAQPSSSLLNHTRQIGIFSVCEKGDEPPPASQHEGGG |
| Documents & Links for Anti CD177 pAb (ATL-HPA077640 w/enhanced validation) | |
| Datasheet | Anti CD177 pAb (ATL-HPA077640 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD177 pAb (ATL-HPA077640 w/enhanced validation) at Atlas |
| Documents & Links for Anti CD177 pAb (ATL-HPA077640 w/enhanced validation) | |
| Datasheet | Anti CD177 pAb (ATL-HPA077640 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD177 pAb (ATL-HPA077640 w/enhanced validation) |