Protein Description: chemokine (C-C motif) receptor 7
Gene Name: CCR7
Alternative Gene Name: BLR2, CD197, CDw197, CMKBR7, EBI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037944: 88%, ENSRNOG00000010665: 88%
Entrez Gene ID: 1236
Uniprot ID: P32248
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CCR7
Alternative Gene Name: BLR2, CD197, CDw197, CMKBR7, EBI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037944: 88%, ENSRNOG00000010665: 88%
Entrez Gene ID: 1236
Uniprot ID: P32248
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKA |
Documents & Links for Anti CCR7 pAb (ATL-HPA074467) | |
Datasheet | Anti CCR7 pAb (ATL-HPA074467) Datasheet (External Link) |
Vendor Page | Anti CCR7 pAb (ATL-HPA074467) at Atlas |
Documents & Links for Anti CCR7 pAb (ATL-HPA074467) | |
Datasheet | Anti CCR7 pAb (ATL-HPA074467) Datasheet (External Link) |
Vendor Page | Anti CCR7 pAb (ATL-HPA074467) |