Description
Product Description
Protein Description: cyclin T1
Gene Name: CCNT1
Alternative Gene Name: CCNT, CYCT1, HIVE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011960: 89%, ENSRNOG00000053054: 93%
Entrez Gene ID: 904
Uniprot ID: O60563
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CCNT1
Alternative Gene Name: CCNT, CYCT1, HIVE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011960: 89%, ENSRNOG00000053054: 93%
Entrez Gene ID: 904
Uniprot ID: O60563
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MEANVKSQYAYAAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEIKMRIKVHAAADKHNSV |
Gene Sequence | MEANVKSQYAYAAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEIKMRIKVHAAADKHNSV |
Gene ID - Mouse | ENSMUSG00000011960 |
Gene ID - Rat | ENSRNOG00000053054 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CCNT1 pAb (ATL-HPA072012) | |
Datasheet | Anti CCNT1 pAb (ATL-HPA072012) Datasheet (External Link) |
Vendor Page | Anti CCNT1 pAb (ATL-HPA072012) at Atlas Antibodies |
Documents & Links for Anti CCNT1 pAb (ATL-HPA072012) | |
Datasheet | Anti CCNT1 pAb (ATL-HPA072012) Datasheet (External Link) |
Vendor Page | Anti CCNT1 pAb (ATL-HPA072012) |