Description
Product Description
Protein Description: cyclin F
Gene Name: CCNF
Alternative Gene Name: FBX1, FBXO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072082: 69%, ENSRNOG00000007483: 69%
Entrez Gene ID: 899
Uniprot ID: P41002
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CCNF
Alternative Gene Name: FBX1, FBXO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072082: 69%, ENSRNOG00000007483: 69%
Entrez Gene ID: 899
Uniprot ID: P41002
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GDQESEGEKEGDVTAPSGILDVTVVYLNPEQHCCQESSDEEACPEDKGPQDPQALALDTQIPATPGPKPLVR |
Gene Sequence | GDQESEGEKEGDVTAPSGILDVTVVYLNPEQHCCQESSDEEACPEDKGPQDPQALALDTQIPATPGPKPLVR |
Gene ID - Mouse | ENSMUSG00000072082 |
Gene ID - Rat | ENSRNOG00000007483 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CCNF pAb (ATL-HPA071600 w/enhanced validation) | |
Datasheet | Anti CCNF pAb (ATL-HPA071600 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CCNF pAb (ATL-HPA071600 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CCNF pAb (ATL-HPA071600 w/enhanced validation) | |
Datasheet | Anti CCNF pAb (ATL-HPA071600 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CCNF pAb (ATL-HPA071600 w/enhanced validation) |