Anti CCNF pAb (ATL-HPA070495 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA070495-25

• 

Product Description

Protein Description: cyclin F
Gene Name: CCNF
Alternative Gene Name: FBX1, FBXO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072082: 78%, ENSRNOG00000007483: 82%
Entrez Gene ID: 899
Uniprot ID: P41002
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YRQVSLTAVKQRFEDKRYGEISQEEVLSYSQLCAALGVTQDSPDPPTFLSTGEIHAFLSSPSGRRTKRKREN
• Gene Sequence: YRQVSLTAVKQRFEDKRYGEISQEEVLSYSQLCAALGVTQDSPDPPTFLSTGEIHAFLSSPSGRRTKRKREN
• Gene ID - Mouse: ENSMUSG00000072082
• Gene ID - Rat: ENSRNOG00000007483
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.