Protein Description: cyclin A1
Gene Name: CCNA1
Alternative Gene Name: CT146
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027793: 90%, ENSRNOG00000014052: 90%
Entrez Gene ID: 8900
Uniprot ID: P78396
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CCNA1
Alternative Gene Name: CT146
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027793: 90%, ENSRNOG00000014052: 90%
Entrez Gene ID: 8900
Uniprot ID: P78396
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | CLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREK |
Documents & Links for Anti CCNA1 pAb (ATL-HPA077614 w/enhanced validation) | |
Datasheet | Anti CCNA1 pAb (ATL-HPA077614 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CCNA1 pAb (ATL-HPA077614 w/enhanced validation) at Atlas |
Documents & Links for Anti CCNA1 pAb (ATL-HPA077614 w/enhanced validation) | |
Datasheet | Anti CCNA1 pAb (ATL-HPA077614 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CCNA1 pAb (ATL-HPA077614 w/enhanced validation) |