Anti CCM2 pAb (ATL-HPA065815)

Catalog No:
ATL-HPA065815-25
$447.00

Description

Product Description

Protein Description: cerebral cavernous malformation 2
Gene Name: CCM2
Alternative Gene Name: C7orf22, MGC4607, OSM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000378: 94%, ENSRNOG00000060825: 95%
Entrez Gene ID: 83605
Uniprot ID: Q9BSQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KDSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSSSTTNGNRATGSSDDRSAPSEGDEWDRMISDISSDVEALGCSMDQDS
Gene Sequence KDSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSSSTTNGNRATGSSDDRSAPSEGDEWDRMISDISSDVEALGCSMDQDS
Gene ID - Mouse ENSMUSG00000000378
Gene ID - Rat ENSRNOG00000060825
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CCM2 pAb (ATL-HPA065815)
Datasheet Anti CCM2 pAb (ATL-HPA065815) Datasheet (External Link)
Vendor Page Anti CCM2 pAb (ATL-HPA065815) at Atlas Antibodies

Documents & Links for Anti CCM2 pAb (ATL-HPA065815)
Datasheet Anti CCM2 pAb (ATL-HPA065815) Datasheet (External Link)
Vendor Page Anti CCM2 pAb (ATL-HPA065815)

Product Description

Protein Description: cerebral cavernous malformation 2
Gene Name: CCM2
Alternative Gene Name: C7orf22, MGC4607, OSM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000378: 94%, ENSRNOG00000060825: 95%
Entrez Gene ID: 83605
Uniprot ID: Q9BSQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KDSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSSSTTNGNRATGSSDDRSAPSEGDEWDRMISDISSDVEALGCSMDQDS
Gene Sequence KDSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSSSTTNGNRATGSSDDRSAPSEGDEWDRMISDISSDVEALGCSMDQDS
Gene ID - Mouse ENSMUSG00000000378
Gene ID - Rat ENSRNOG00000060825
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CCM2 pAb (ATL-HPA065815)
Datasheet Anti CCM2 pAb (ATL-HPA065815) Datasheet (External Link)
Vendor Page Anti CCM2 pAb (ATL-HPA065815) at Atlas Antibodies

Documents & Links for Anti CCM2 pAb (ATL-HPA065815)
Datasheet Anti CCM2 pAb (ATL-HPA065815) Datasheet (External Link)
Vendor Page Anti CCM2 pAb (ATL-HPA065815)