Description
Product Description
Protein Description: cerebral cavernous malformation 2
Gene Name: CCM2
Alternative Gene Name: C7orf22, MGC4607, OSM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000378: 94%, ENSRNOG00000060825: 95%
Entrez Gene ID: 83605
Uniprot ID: Q9BSQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CCM2
Alternative Gene Name: C7orf22, MGC4607, OSM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000378: 94%, ENSRNOG00000060825: 95%
Entrez Gene ID: 83605
Uniprot ID: Q9BSQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KDSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSSSTTNGNRATGSSDDRSAPSEGDEWDRMISDISSDVEALGCSMDQDS |
Gene Sequence | KDSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSSSTTNGNRATGSSDDRSAPSEGDEWDRMISDISSDVEALGCSMDQDS |
Gene ID - Mouse | ENSMUSG00000000378 |
Gene ID - Rat | ENSRNOG00000060825 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CCM2 pAb (ATL-HPA065815) | |
Datasheet | Anti CCM2 pAb (ATL-HPA065815) Datasheet (External Link) |
Vendor Page | Anti CCM2 pAb (ATL-HPA065815) at Atlas Antibodies |
Documents & Links for Anti CCM2 pAb (ATL-HPA065815) | |
Datasheet | Anti CCM2 pAb (ATL-HPA065815) Datasheet (External Link) |
Vendor Page | Anti CCM2 pAb (ATL-HPA065815) |