Description
Product Description
Protein Description: C-C motif chemokine ligand 28
Gene Name: CCL28
Alternative Gene Name: CCK1, MEC, SCYA28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074715: 87%, ENSRNOG00000059640: 94%
Entrez Gene ID: 56477
Uniprot ID: Q9NRJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CCL28
Alternative Gene Name: CCK1, MEC, SCYA28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074715: 87%, ENSRNOG00000059640: 94%
Entrez Gene ID: 56477
Uniprot ID: Q9NRJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVS |
Gene Sequence | AILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVS |
Gene ID - Mouse | ENSMUSG00000074715 |
Gene ID - Rat | ENSRNOG00000059640 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CCL28 pAb (ATL-HPA077434) | |
Datasheet | Anti CCL28 pAb (ATL-HPA077434) Datasheet (External Link) |
Vendor Page | Anti CCL28 pAb (ATL-HPA077434) at Atlas Antibodies |
Documents & Links for Anti CCL28 pAb (ATL-HPA077434) | |
Datasheet | Anti CCL28 pAb (ATL-HPA077434) Datasheet (External Link) |
Vendor Page | Anti CCL28 pAb (ATL-HPA077434) |