Protein Description: chemokine (C-C motif) ligand 19
Gene Name: CCL19
Alternative Gene Name: CKb11, ELC, exodus-3, MIP-3b, SCYA19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094661: 76%, ENSRNOG00000015668: 76%
Entrez Gene ID: 6363
Uniprot ID: Q99731
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CCL19
Alternative Gene Name: CKb11, ELC, exodus-3, MIP-3b, SCYA19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094661: 76%, ENSRNOG00000015668: 76%
Entrez Gene ID: 6363
Uniprot ID: Q99731
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS |
Documents & Links for Anti CCL19 pAb (ATL-HPA067758 w/enhanced validation) | |
Datasheet | Anti CCL19 pAb (ATL-HPA067758 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CCL19 pAb (ATL-HPA067758 w/enhanced validation) at Atlas |
Documents & Links for Anti CCL19 pAb (ATL-HPA067758 w/enhanced validation) | |
Datasheet | Anti CCL19 pAb (ATL-HPA067758 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CCL19 pAb (ATL-HPA067758 w/enhanced validation) |