Anti CCL19 pAb (ATL-HPA067758 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA067758-25

• 

Product Description

Protein Description: chemokine (C-C motif) ligand 19
Gene Name: CCL19
Alternative Gene Name: CKb11, ELC, exodus-3, MIP-3b, SCYA19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094661: 76%, ENSRNOG00000015668: 76%
Entrez Gene ID: 6363
Uniprot ID: Q99731
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
• Gene Sequence: LLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
• Gene ID - Mouse: ENSMUSG00000094661
• Gene ID - Rat: ENSRNOG00000015668
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.