Protein Description: cholecystokinin
Gene Name: CCK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032532: 84%, ENSRNOG00000019321: 82%
Entrez Gene ID: 885
Uniprot ID: P06307
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CCK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032532: 84%, ENSRNOG00000019321: 82%
Entrez Gene ID: 885
Uniprot ID: P06307
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMG |
Documents & Links for Anti CCK pAb (ATL-HPA069515 w/enhanced validation) | |
Datasheet | Anti CCK pAb (ATL-HPA069515 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CCK pAb (ATL-HPA069515 w/enhanced validation) at Atlas |
Documents & Links for Anti CCK pAb (ATL-HPA069515 w/enhanced validation) | |
Datasheet | Anti CCK pAb (ATL-HPA069515 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CCK pAb (ATL-HPA069515 w/enhanced validation) |