Protein Description: coiled-coil domain containing 9
Gene Name: CCDC9
Alternative Gene Name: DKFZP586M1019
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041375: 73%, ENSRNOG00000048848: 76%
Entrez Gene ID: 26093
Uniprot ID: Q9Y3X0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CCDC9
Alternative Gene Name: DKFZP586M1019
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041375: 73%, ENSRNOG00000048848: 76%
Entrez Gene ID: 26093
Uniprot ID: Q9Y3X0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PTFGEFLSQHKAEASSRRRRKSSRPQAKAAPRAYSDHDDRWETKEGAASPAPETPQPTSPETSPKETPMQPPEIPAPA |
| Documents & Links for Anti CCDC9 pAb (ATL-HPA072007) | |
| Datasheet | Anti CCDC9 pAb (ATL-HPA072007) Datasheet (External Link) |
| Vendor Page | Anti CCDC9 pAb (ATL-HPA072007) at Atlas |
| Documents & Links for Anti CCDC9 pAb (ATL-HPA072007) | |
| Datasheet | Anti CCDC9 pAb (ATL-HPA072007) Datasheet (External Link) |
| Vendor Page | Anti CCDC9 pAb (ATL-HPA072007) |