Description
Product Description
Protein Description: coiled-coil domain containing 84
Gene Name: CCDC84
Alternative Gene Name: DLNB14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043923: 84%, ENSRNOG00000012137: 85%
Entrez Gene ID: 338657
Uniprot ID: Q86UT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CCDC84
Alternative Gene Name: DLNB14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043923: 84%, ENSRNOG00000012137: 85%
Entrez Gene ID: 338657
Uniprot ID: Q86UT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SGATPPWMIQDEEYIAGNQEIGPSYEEFLKEKEKQKLKKLPPDRVGANFDHSSRTSAGWLPSFGRVWNNGRRWQSRHQFKTEAAAMKKQSHTE |
Gene Sequence | SGATPPWMIQDEEYIAGNQEIGPSYEEFLKEKEKQKLKKLPPDRVGANFDHSSRTSAGWLPSFGRVWNNGRRWQSRHQFKTEAAAMKKQSHTE |
Gene ID - Mouse | ENSMUSG00000043923 |
Gene ID - Rat | ENSRNOG00000012137 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CCDC84 pAb (ATL-HPA071715) | |
Datasheet | Anti CCDC84 pAb (ATL-HPA071715) Datasheet (External Link) |
Vendor Page | Anti CCDC84 pAb (ATL-HPA071715) at Atlas Antibodies |
Documents & Links for Anti CCDC84 pAb (ATL-HPA071715) | |
Datasheet | Anti CCDC84 pAb (ATL-HPA071715) Datasheet (External Link) |
Vendor Page | Anti CCDC84 pAb (ATL-HPA071715) |
Citations
Citations for Anti CCDC84 pAb (ATL-HPA071715) – 1 Found |
de Wolf, Bas; Oghabian, Ali; Akinyi, Maureen V; Hanks, Sandra; Tromer, Eelco C; van Hooff, Jolien J E; van Voorthuijsen, Lisa; van Rooijen, Laura E; Verbeeren, Jens; Uijttewaal, Esther C H; Baltissen, Marijke P A; Yost, Shawn; Piloquet, Philippe; Vermeulen, Michiel; Snel, Berend; Isidor, Bertrand; Rahman, Nazneen; Frilander, Mikko J; Kops, Geert J P L. Chromosomal instability by mutations in the novel minor spliceosome component CENATAC. The Embo Journal. 2021;40(14):e106536. PubMed |