Description
Product Description
Protein Description: coiled-coil domain containing 82
Gene Name: CCDC82
Alternative Gene Name: FLJ23518
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079084: 88%, ENSRNOG00000005713: 85%
Entrez Gene ID: 79780
Uniprot ID: Q8N4S0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CCDC82
Alternative Gene Name: FLJ23518
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079084: 88%, ENSRNOG00000005713: 85%
Entrez Gene ID: 79780
Uniprot ID: Q8N4S0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DEEGDEENKNQQGEKLTTSQLKLVKRNSLYSFSDHYTHFERVVKALLINALDESFLGTLYDGTRQKSYAKDMLTSLHYLDNRFVQP |
Gene Sequence | DEEGDEENKNQQGEKLTTSQLKLVKRNSLYSFSDHYTHFERVVKALLINALDESFLGTLYDGTRQKSYAKDMLTSLHYLDNRFVQP |
Gene ID - Mouse | ENSMUSG00000079084 |
Gene ID - Rat | ENSRNOG00000005713 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CCDC82 pAb (ATL-HPA070631) | |
Datasheet | Anti CCDC82 pAb (ATL-HPA070631) Datasheet (External Link) |
Vendor Page | Anti CCDC82 pAb (ATL-HPA070631) at Atlas Antibodies |
Documents & Links for Anti CCDC82 pAb (ATL-HPA070631) | |
Datasheet | Anti CCDC82 pAb (ATL-HPA070631) Datasheet (External Link) |
Vendor Page | Anti CCDC82 pAb (ATL-HPA070631) |