Description
Product Description
Protein Description: coiled-coil domain containing 7
Gene Name: CCDC7
Alternative Gene Name: BIOT2, C10orf68, FLJ13031, FLJ32762
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056018: 40%, ENSRNOG00000050191: 42%
Entrez Gene ID: 79741
Uniprot ID: Q96M83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CCDC7
Alternative Gene Name: BIOT2, C10orf68, FLJ13031, FLJ32762
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056018: 40%, ENSRNOG00000050191: 42%
Entrez Gene ID: 79741
Uniprot ID: Q96M83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SKSSVKVMLSKTMDKENRPEAVKSCEALAQKIEEFLEAHSTDEFKDVSATEPQTAHSMTNRFNAMLKVFENQ |
Gene Sequence | SKSSVKVMLSKTMDKENRPEAVKSCEALAQKIEEFLEAHSTDEFKDVSATEPQTAHSMTNRFNAMLKVFENQ |
Gene ID - Mouse | ENSMUSG00000056018 |
Gene ID - Rat | ENSRNOG00000050191 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CCDC7 pAb (ATL-HPA075536) | |
Datasheet | Anti CCDC7 pAb (ATL-HPA075536) Datasheet (External Link) |
Vendor Page | Anti CCDC7 pAb (ATL-HPA075536) at Atlas Antibodies |
Documents & Links for Anti CCDC7 pAb (ATL-HPA075536) | |
Datasheet | Anti CCDC7 pAb (ATL-HPA075536) Datasheet (External Link) |
Vendor Page | Anti CCDC7 pAb (ATL-HPA075536) |