Description
Product Description
Protein Description: coiled-coil domain containing 47
Gene Name: CCDC47
Alternative Gene Name: GK001
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078622: 96%, ENSRNOG00000009006: 95%
Entrez Gene ID: 57003
Uniprot ID: Q96A33
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CCDC47
Alternative Gene Name: GK001
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078622: 96%, ENSRNOG00000009006: 95%
Entrez Gene ID: 57003
Uniprot ID: Q96A33
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AKFDDFEDEEDIVEYDDNDFAEFEDVMEDSVTESPQRVIITEDDEDETTVELEGQDENQEGDFEDADTQEGDTESEPYDDEEFEGYEDKPDTSSSK |
Gene Sequence | AKFDDFEDEEDIVEYDDNDFAEFEDVMEDSVTESPQRVIITEDDEDETTVELEGQDENQEGDFEDADTQEGDTESEPYDDEEFEGYEDKPDTSSSK |
Gene ID - Mouse | ENSMUSG00000078622 |
Gene ID - Rat | ENSRNOG00000009006 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CCDC47 pAb (ATL-HPA075958) | |
Datasheet | Anti CCDC47 pAb (ATL-HPA075958) Datasheet (External Link) |
Vendor Page | Anti CCDC47 pAb (ATL-HPA075958) at Atlas Antibodies |
Documents & Links for Anti CCDC47 pAb (ATL-HPA075958) | |
Datasheet | Anti CCDC47 pAb (ATL-HPA075958) Datasheet (External Link) |
Vendor Page | Anti CCDC47 pAb (ATL-HPA075958) |