Anti CCDC47 pAb (ATL-HPA075958)

Catalog No:
ATL-HPA075958-25
$447.00

Description

Product Description

Protein Description: coiled-coil domain containing 47
Gene Name: CCDC47
Alternative Gene Name: GK001
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078622: 96%, ENSRNOG00000009006: 95%
Entrez Gene ID: 57003
Uniprot ID: Q96A33
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKFDDFEDEEDIVEYDDNDFAEFEDVMEDSVTESPQRVIITEDDEDETTVELEGQDENQEGDFEDADTQEGDTESEPYDDEEFEGYEDKPDTSSSK
Gene Sequence AKFDDFEDEEDIVEYDDNDFAEFEDVMEDSVTESPQRVIITEDDEDETTVELEGQDENQEGDFEDADTQEGDTESEPYDDEEFEGYEDKPDTSSSK
Gene ID - Mouse ENSMUSG00000078622
Gene ID - Rat ENSRNOG00000009006
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CCDC47 pAb (ATL-HPA075958)
Datasheet Anti CCDC47 pAb (ATL-HPA075958) Datasheet (External Link)
Vendor Page Anti CCDC47 pAb (ATL-HPA075958) at Atlas Antibodies

Documents & Links for Anti CCDC47 pAb (ATL-HPA075958)
Datasheet Anti CCDC47 pAb (ATL-HPA075958) Datasheet (External Link)
Vendor Page Anti CCDC47 pAb (ATL-HPA075958)

Product Description

Protein Description: coiled-coil domain containing 47
Gene Name: CCDC47
Alternative Gene Name: GK001
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078622: 96%, ENSRNOG00000009006: 95%
Entrez Gene ID: 57003
Uniprot ID: Q96A33
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKFDDFEDEEDIVEYDDNDFAEFEDVMEDSVTESPQRVIITEDDEDETTVELEGQDENQEGDFEDADTQEGDTESEPYDDEEFEGYEDKPDTSSSK
Gene Sequence AKFDDFEDEEDIVEYDDNDFAEFEDVMEDSVTESPQRVIITEDDEDETTVELEGQDENQEGDFEDADTQEGDTESEPYDDEEFEGYEDKPDTSSSK
Gene ID - Mouse ENSMUSG00000078622
Gene ID - Rat ENSRNOG00000009006
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CCDC47 pAb (ATL-HPA075958)
Datasheet Anti CCDC47 pAb (ATL-HPA075958) Datasheet (External Link)
Vendor Page Anti CCDC47 pAb (ATL-HPA075958) at Atlas Antibodies

Documents & Links for Anti CCDC47 pAb (ATL-HPA075958)
Datasheet Anti CCDC47 pAb (ATL-HPA075958) Datasheet (External Link)
Vendor Page Anti CCDC47 pAb (ATL-HPA075958)