Description
Product Description
Protein Description: coiled-coil domain containing 36
Gene Name: CCDC36
Alternative Gene Name: CT74, FLJ25320
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047220: 29%, ENSRNOG00000048919: 30%
Entrez Gene ID: 339834
Uniprot ID: Q8IYA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CCDC36
Alternative Gene Name: CT74, FLJ25320
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047220: 29%, ENSRNOG00000048919: 30%
Entrez Gene ID: 339834
Uniprot ID: Q8IYA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LCDPREHLVIKQKDGTVEMRGKDKKQQPRKAHRAHRGRLIASKQKQIPIQTCKFNSKYQSPQPAISVPQSPFLGQQEPRAQPLHLQCPR |
Gene Sequence | LCDPREHLVIKQKDGTVEMRGKDKKQQPRKAHRAHRGRLIASKQKQIPIQTCKFNSKYQSPQPAISVPQSPFLGQQEPRAQPLHLQCPR |
Gene ID - Mouse | ENSMUSG00000047220 |
Gene ID - Rat | ENSRNOG00000048919 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CCDC36 pAb (ATL-HPA069534) | |
Datasheet | Anti CCDC36 pAb (ATL-HPA069534) Datasheet (External Link) |
Vendor Page | Anti CCDC36 pAb (ATL-HPA069534) at Atlas Antibodies |
Documents & Links for Anti CCDC36 pAb (ATL-HPA069534) | |
Datasheet | Anti CCDC36 pAb (ATL-HPA069534) Datasheet (External Link) |
Vendor Page | Anti CCDC36 pAb (ATL-HPA069534) |