Anti CCDC24 pAb (ATL-HPA061710)

Atlas Antibodies

Catalog No: ATL-HPA061710-25

• 

Product Description

Protein Description: coiled-coil domain containing 24
Gene Name: CCDC24
Alternative Gene Name: MGC45441
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078588: 66%, ENSRNOG00000019586: 70%
Entrez Gene ID: 149473
Uniprot ID: Q8N4L8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IIKDQLNVSNIDQVARHLRGLLEEECHTLEREILILQRCLEEEYLRPCHPSEAALEPTLAELKEQKKAMEQEL
• Gene Sequence: IIKDQLNVSNIDQVARHLRGLLEEECHTLEREILILQRCLEEEYLRPCHPSEAALEPTLAELKEQKKAMEQEL
• Gene ID - Mouse: ENSMUSG00000078588
• Gene ID - Rat: ENSRNOG00000019586
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.