Description
Product Description
Protein Description: coiled-coil domain containing 24
Gene Name: CCDC24
Alternative Gene Name: MGC45441
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078588: 66%, ENSRNOG00000019586: 70%
Entrez Gene ID: 149473
Uniprot ID: Q8N4L8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CCDC24
Alternative Gene Name: MGC45441
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078588: 66%, ENSRNOG00000019586: 70%
Entrez Gene ID: 149473
Uniprot ID: Q8N4L8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IIKDQLNVSNIDQVARHLRGLLEEECHTLEREILILQRCLEEEYLRPCHPSEAALEPTLAELKEQKKAMEQEL |
Gene Sequence | IIKDQLNVSNIDQVARHLRGLLEEECHTLEREILILQRCLEEEYLRPCHPSEAALEPTLAELKEQKKAMEQEL |
Gene ID - Mouse | ENSMUSG00000078588 |
Gene ID - Rat | ENSRNOG00000019586 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CCDC24 pAb (ATL-HPA061710) | |
Datasheet | Anti CCDC24 pAb (ATL-HPA061710) Datasheet (External Link) |
Vendor Page | Anti CCDC24 pAb (ATL-HPA061710) at Atlas Antibodies |
Documents & Links for Anti CCDC24 pAb (ATL-HPA061710) | |
Datasheet | Anti CCDC24 pAb (ATL-HPA061710) Datasheet (External Link) |
Vendor Page | Anti CCDC24 pAb (ATL-HPA061710) |