Anti CCDC168 pAb (ATL-HPA078547)

Catalog No:
ATL-HPA078547-25
$447.00

Description

Product Description

Protein Description: coiled-coil domain containing 168
Gene Name: CCDC168
Alternative Gene Name: C13orf40, FLJ40176
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091844: 40%, ENSRNOG00000023089: 31%
Entrez Gene ID: 643677
Uniprot ID: Q8NDH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RNATGSAVSCETQISEDFVDIQTDIESPADLDECSCLEVSESEECVFLEANSYLSQESENILFELQTGIPLENVYKITTDLKSFYSEDSGSHCT
Gene Sequence RNATGSAVSCETQISEDFVDIQTDIESPADLDECSCLEVSESEECVFLEANSYLSQESENILFELQTGIPLENVYKITTDLKSFYSEDSGSHCT
Gene ID - Mouse ENSMUSG00000091844
Gene ID - Rat ENSRNOG00000023089
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CCDC168 pAb (ATL-HPA078547)
Datasheet Anti CCDC168 pAb (ATL-HPA078547) Datasheet (External Link)
Vendor Page Anti CCDC168 pAb (ATL-HPA078547) at Atlas Antibodies

Documents & Links for Anti CCDC168 pAb (ATL-HPA078547)
Datasheet Anti CCDC168 pAb (ATL-HPA078547) Datasheet (External Link)
Vendor Page Anti CCDC168 pAb (ATL-HPA078547)

Product Description

Protein Description: coiled-coil domain containing 168
Gene Name: CCDC168
Alternative Gene Name: C13orf40, FLJ40176
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091844: 40%, ENSRNOG00000023089: 31%
Entrez Gene ID: 643677
Uniprot ID: Q8NDH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RNATGSAVSCETQISEDFVDIQTDIESPADLDECSCLEVSESEECVFLEANSYLSQESENILFELQTGIPLENVYKITTDLKSFYSEDSGSHCT
Gene Sequence RNATGSAVSCETQISEDFVDIQTDIESPADLDECSCLEVSESEECVFLEANSYLSQESENILFELQTGIPLENVYKITTDLKSFYSEDSGSHCT
Gene ID - Mouse ENSMUSG00000091844
Gene ID - Rat ENSRNOG00000023089
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CCDC168 pAb (ATL-HPA078547)
Datasheet Anti CCDC168 pAb (ATL-HPA078547) Datasheet (External Link)
Vendor Page Anti CCDC168 pAb (ATL-HPA078547) at Atlas Antibodies

Documents & Links for Anti CCDC168 pAb (ATL-HPA078547)
Datasheet Anti CCDC168 pAb (ATL-HPA078547) Datasheet (External Link)
Vendor Page Anti CCDC168 pAb (ATL-HPA078547)