Description
Product Description
Protein Description: coiled-coil domain containing 168
Gene Name: CCDC168
Alternative Gene Name: C13orf40, FLJ40176
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091844: 57%, ENSRNOG00000023089: 50%
Entrez Gene ID: 643677
Uniprot ID: Q8NDH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CCDC168
Alternative Gene Name: C13orf40, FLJ40176
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091844: 57%, ENSRNOG00000023089: 50%
Entrez Gene ID: 643677
Uniprot ID: Q8NDH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TPPSCKSHKSRKYRSSSKMKSPDWLCHSSSNTAEIQSRSSSVSFSEEKISWTTKSRTSYSSAPLTESNIKSHLAKNQGKSHRHPESQERKKARSDLFRK |
Gene Sequence | TPPSCKSHKSRKYRSSSKMKSPDWLCHSSSNTAEIQSRSSSVSFSEEKISWTTKSRTSYSSAPLTESNIKSHLAKNQGKSHRHPESQERKKARSDLFRK |
Gene ID - Mouse | ENSMUSG00000091844 |
Gene ID - Rat | ENSRNOG00000023089 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CCDC168 pAb (ATL-HPA058793) | |
Datasheet | Anti CCDC168 pAb (ATL-HPA058793) Datasheet (External Link) |
Vendor Page | Anti CCDC168 pAb (ATL-HPA058793) at Atlas Antibodies |
Documents & Links for Anti CCDC168 pAb (ATL-HPA058793) | |
Datasheet | Anti CCDC168 pAb (ATL-HPA058793) Datasheet (External Link) |
Vendor Page | Anti CCDC168 pAb (ATL-HPA058793) |