Anti CCDC168 pAb (ATL-HPA058793)

Catalog No:
ATL-HPA058793-25
$447.00

Description

Product Description

Protein Description: coiled-coil domain containing 168
Gene Name: CCDC168
Alternative Gene Name: C13orf40, FLJ40176
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091844: 57%, ENSRNOG00000023089: 50%
Entrez Gene ID: 643677
Uniprot ID: Q8NDH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPPSCKSHKSRKYRSSSKMKSPDWLCHSSSNTAEIQSRSSSVSFSEEKISWTTKSRTSYSSAPLTESNIKSHLAKNQGKSHRHPESQERKKARSDLFRK
Gene Sequence TPPSCKSHKSRKYRSSSKMKSPDWLCHSSSNTAEIQSRSSSVSFSEEKISWTTKSRTSYSSAPLTESNIKSHLAKNQGKSHRHPESQERKKARSDLFRK
Gene ID - Mouse ENSMUSG00000091844
Gene ID - Rat ENSRNOG00000023089
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CCDC168 pAb (ATL-HPA058793)
Datasheet Anti CCDC168 pAb (ATL-HPA058793) Datasheet (External Link)
Vendor Page Anti CCDC168 pAb (ATL-HPA058793) at Atlas Antibodies

Documents & Links for Anti CCDC168 pAb (ATL-HPA058793)
Datasheet Anti CCDC168 pAb (ATL-HPA058793) Datasheet (External Link)
Vendor Page Anti CCDC168 pAb (ATL-HPA058793)

Product Description

Protein Description: coiled-coil domain containing 168
Gene Name: CCDC168
Alternative Gene Name: C13orf40, FLJ40176
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091844: 57%, ENSRNOG00000023089: 50%
Entrez Gene ID: 643677
Uniprot ID: Q8NDH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPPSCKSHKSRKYRSSSKMKSPDWLCHSSSNTAEIQSRSSSVSFSEEKISWTTKSRTSYSSAPLTESNIKSHLAKNQGKSHRHPESQERKKARSDLFRK
Gene Sequence TPPSCKSHKSRKYRSSSKMKSPDWLCHSSSNTAEIQSRSSSVSFSEEKISWTTKSRTSYSSAPLTESNIKSHLAKNQGKSHRHPESQERKKARSDLFRK
Gene ID - Mouse ENSMUSG00000091844
Gene ID - Rat ENSRNOG00000023089
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CCDC168 pAb (ATL-HPA058793)
Datasheet Anti CCDC168 pAb (ATL-HPA058793) Datasheet (External Link)
Vendor Page Anti CCDC168 pAb (ATL-HPA058793) at Atlas Antibodies

Documents & Links for Anti CCDC168 pAb (ATL-HPA058793)
Datasheet Anti CCDC168 pAb (ATL-HPA058793) Datasheet (External Link)
Vendor Page Anti CCDC168 pAb (ATL-HPA058793)