Anti CCDC122 pAb (ATL-HPA061456)

Atlas Antibodies

Catalog No: ATL-HPA061456-25

• 

Product Description

Protein Description: coiled-coil domain containing 122
Gene Name: CCDC122
Alternative Gene Name: FLJ31846
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034795: 73%, ENSRNOG00000042404: 69%
Entrez Gene ID: 160857
Uniprot ID: Q5T0U0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NTKLHCDSLETQIKSLHSENVKLKFDIETAQEDFEEHMIKYNAYYAKIKAHK
• Gene Sequence: NTKLHCDSLETQIKSLHSENVKLKFDIETAQEDFEEHMIKYNAYYAKIKAHK
• Gene ID - Mouse: ENSMUSG00000034795
• Gene ID - Rat: ENSRNOG00000042404
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.