Description
Product Description
Protein Description: coiled-coil domain containing 12
Gene Name: CCDC12
Alternative Gene Name: MGC23918
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019659: 90%, ENSRNOG00000020946: 91%
Entrez Gene ID: 151903
Uniprot ID: Q8WUD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CCDC12
Alternative Gene Name: MGC23918
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019659: 90%, ENSRNOG00000020946: 91%
Entrez Gene ID: 151903
Uniprot ID: Q8WUD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAK |
Gene Sequence | EALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAK |
Gene ID - Mouse | ENSMUSG00000019659 |
Gene ID - Rat | ENSRNOG00000020946 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CCDC12 pAb (ATL-HPA056814) | |
Datasheet | Anti CCDC12 pAb (ATL-HPA056814) Datasheet (External Link) |
Vendor Page | Anti CCDC12 pAb (ATL-HPA056814) at Atlas Antibodies |
Documents & Links for Anti CCDC12 pAb (ATL-HPA056814) | |
Datasheet | Anti CCDC12 pAb (ATL-HPA056814) Datasheet (External Link) |
Vendor Page | Anti CCDC12 pAb (ATL-HPA056814) |