Protein Description: coiled-coil and C2 domain containing 2B
Gene Name: CC2D2B
Alternative Gene Name: bA248J23.4, C10orf130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000108929: 59%, ENSRNOG00000003596: 28%
Entrez Gene ID: 387707
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CC2D2B
Alternative Gene Name: bA248J23.4, C10orf130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000108929: 59%, ENSRNOG00000003596: 28%
Entrez Gene ID: 387707
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LSGEEGSALGKSSEQRPVNRSYPKCFSLGVNLQNVAESEEEEFMKEFILTDILKVKAADYEDDQEQIK |
| Documents & Links for Anti CC2D2B pAb (ATL-HPA072122) | |
| Datasheet | Anti CC2D2B pAb (ATL-HPA072122) Datasheet (External Link) |
| Vendor Page | Anti CC2D2B pAb (ATL-HPA072122) at Atlas |
| Documents & Links for Anti CC2D2B pAb (ATL-HPA072122) | |
| Datasheet | Anti CC2D2B pAb (ATL-HPA072122) Datasheet (External Link) |
| Vendor Page | Anti CC2D2B pAb (ATL-HPA072122) |