Protein Description: core-binding factor, runt domain, alpha subunit 2; translocated to, 3
Gene Name: CBFA2T3
Alternative Gene Name: MTG16, MTGR2, ZMYND4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006362: 42%, ENSRNOG00000014723: 45%
Entrez Gene ID: 863
Uniprot ID: O75081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CBFA2T3
Alternative Gene Name: MTG16, MTGR2, ZMYND4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006362: 42%, ENSRNOG00000014723: 45%
Entrez Gene ID: 863
Uniprot ID: O75081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGPAPVDRKAKASAMPDSPAEVKTQPR |
Documents & Links for Anti CBFA2T3 pAb (ATL-HPA065890) | |
Datasheet | Anti CBFA2T3 pAb (ATL-HPA065890) Datasheet (External Link) |
Vendor Page | Anti CBFA2T3 pAb (ATL-HPA065890) at Atlas |
Documents & Links for Anti CBFA2T3 pAb (ATL-HPA065890) | |
Datasheet | Anti CBFA2T3 pAb (ATL-HPA065890) Datasheet (External Link) |
Vendor Page | Anti CBFA2T3 pAb (ATL-HPA065890) |