Anti CASTOR1 pAb (ATL-HPA073183)

Atlas Antibodies

Catalog No: ATL-HPA073183-25

• 
• 

Product Description

Protein Description: cytosolic arginine sensor for mTORC1 subunit 1
Gene Name: CASTOR1
Alternative Gene Name: GATSL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020424: 94%, ENSRNOG00000006740: 93%
Entrez Gene ID: 652968
Uniprot ID: Q8WTX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EQDLSVVIHTLAQEFDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSPQNRFCVLTLDPET
• Gene Sequence: EQDLSVVIHTLAQEFDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSPQNRFCVLTLDPET
• Gene ID - Mouse: ENSMUSG00000020424
• Gene ID - Rat: ENSRNOG00000006740
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.