Protein Description: calpastatin
Gene Name: CAST
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021585: 74%, ENSRNOG00000010286: 72%
Entrez Gene ID: 831
Uniprot ID: P20810
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CAST
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021585: 74%, ENSRNOG00000010286: 72%
Entrez Gene ID: 831
Uniprot ID: P20810
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSA |
| Documents & Links for Anti CAST pAb (ATL-HPA075906) | |
| Datasheet | Anti CAST pAb (ATL-HPA075906) Datasheet (External Link) |
| Vendor Page | Anti CAST pAb (ATL-HPA075906) at Atlas |
| Documents & Links for Anti CAST pAb (ATL-HPA075906) | |
| Datasheet | Anti CAST pAb (ATL-HPA075906) Datasheet (External Link) |
| Vendor Page | Anti CAST pAb (ATL-HPA075906) |