Anti CASKIN1 pAb (ATL-HPA076882)

Atlas Antibodies

Catalog No: ATL-HPA076882-25

• 

Product Description

Protein Description: CASK interacting protein 1
Gene Name: CASKIN1
Alternative Gene Name: ANKS5A, KIAA1306
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033597: 82%, ENSRNOG00000003195: 83%
Entrez Gene ID: 57524
Uniprot ID: Q8WXD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVKHKEAIGPGGEVVNRRRTLSGPVTGLLATARRGPGESADPGPFVEDGTGRQRPRGPSK
• Gene Sequence: SVKHKEAIGPGGEVVNRRRTLSGPVTGLLATARRGPGESADPGPFVEDGTGRQRPRGPSK
• Gene ID - Mouse: ENSMUSG00000033597
• Gene ID - Rat: ENSRNOG00000003195
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.