Description
Product Description
Protein Description: CASK interacting protein 1
Gene Name: CASKIN1
Alternative Gene Name: ANKS5A, KIAA1306
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033597: 100%, ENSRNOG00000003195: 100%
Entrez Gene ID: 57524
Uniprot ID: Q8WXD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CASKIN1
Alternative Gene Name: ANKS5A, KIAA1306
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033597: 100%, ENSRNOG00000003195: 100%
Entrez Gene ID: 57524
Uniprot ID: Q8WXD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GKEQELVQAVKAEDVGTAQRLLQRPRPGKAKLLGSTKKINVNFQDPDGFSA |
Gene Sequence | GKEQELVQAVKAEDVGTAQRLLQRPRPGKAKLLGSTKKINVNFQDPDGFSA |
Gene ID - Mouse | ENSMUSG00000033597 |
Gene ID - Rat | ENSRNOG00000003195 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CASKIN1 pAb (ATL-HPA055990 w/enhanced validation) | |
Datasheet | Anti CASKIN1 pAb (ATL-HPA055990 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CASKIN1 pAb (ATL-HPA055990 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CASKIN1 pAb (ATL-HPA055990 w/enhanced validation) | |
Datasheet | Anti CASKIN1 pAb (ATL-HPA055990 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CASKIN1 pAb (ATL-HPA055990 w/enhanced validation) |