Anti CARM1 pAb (ATL-HPA069313)

Catalog No:
ATL-HPA069313-25
$395.00

Description

Product Description

Protein Description: coactivator associated arginine methyltransferase 1
Gene Name: CARM1
Alternative Gene Name: PRMT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032185: 95%, ENSRNOG00000031129: 95%
Entrez Gene ID: 10498
Uniprot ID: Q86X55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNTMHYGS
Gene Sequence NMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNTMHYGS
Gene ID - Mouse ENSMUSG00000032185
Gene ID - Rat ENSRNOG00000031129
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CARM1 pAb (ATL-HPA069313)
Datasheet Anti CARM1 pAb (ATL-HPA069313) Datasheet (External Link)
Vendor Page Anti CARM1 pAb (ATL-HPA069313) at Atlas Antibodies

Documents & Links for Anti CARM1 pAb (ATL-HPA069313)
Datasheet Anti CARM1 pAb (ATL-HPA069313) Datasheet (External Link)
Vendor Page Anti CARM1 pAb (ATL-HPA069313)

Product Description

Protein Description: coactivator associated arginine methyltransferase 1
Gene Name: CARM1
Alternative Gene Name: PRMT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032185: 95%, ENSRNOG00000031129: 95%
Entrez Gene ID: 10498
Uniprot ID: Q86X55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNTMHYGS
Gene Sequence NMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNTMHYGS
Gene ID - Mouse ENSMUSG00000032185
Gene ID - Rat ENSRNOG00000031129
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CARM1 pAb (ATL-HPA069313)
Datasheet Anti CARM1 pAb (ATL-HPA069313) Datasheet (External Link)
Vendor Page Anti CARM1 pAb (ATL-HPA069313) at Atlas Antibodies

Documents & Links for Anti CARM1 pAb (ATL-HPA069313)
Datasheet Anti CARM1 pAb (ATL-HPA069313) Datasheet (External Link)
Vendor Page Anti CARM1 pAb (ATL-HPA069313)