Protein Description: coactivator-associated arginine methyltransferase 1
Gene Name: CARM1
Alternative Gene Name: PRMT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032185: 100%, ENSRNOG00000031129: 100%
Entrez Gene ID: 10498
Uniprot ID: Q86X55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CARM1
Alternative Gene Name: PRMT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032185: 100%, ENSRNOG00000031129: 100%
Entrez Gene ID: 10498
Uniprot ID: Q86X55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFI |
Gene Sequence | HLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFI |
Gene ID - Mouse | ENSMUSG00000032185 |
Gene ID - Rat | ENSRNOG00000031129 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CARM1 pAb (ATL-HPA048073) | |
Datasheet | Anti CARM1 pAb (ATL-HPA048073) Datasheet (External Link) |
Vendor Page | Anti CARM1 pAb (ATL-HPA048073) at Atlas |
Documents & Links for Anti CARM1 pAb (ATL-HPA048073) | |
Datasheet | Anti CARM1 pAb (ATL-HPA048073) Datasheet (External Link) |
Vendor Page | Anti CARM1 pAb (ATL-HPA048073) |