Anti CAPZB pAb (ATL-HPA056066)

Atlas Antibodies

Catalog No: ATL-HPA056066-100

• 
• 

Product Description

Protein Description: capping protein (actin filament) muscle Z-line, beta
Gene Name: CAPZB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028745: 100%, ENSRNOG00000007330: 100%
Entrez Gene ID: 832
Uniprot ID: P47756
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSP
• Gene Sequence: GCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSP
• Gene ID - Mouse: ENSMUSG00000028745
• Gene ID - Rat: ENSRNOG00000007330
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.