Protein Description: cell cycle associated protein 1
Gene Name: CAPRIN1
Alternative Gene Name: caprin-1, GPIAP1, M11S1, RNG105
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027184: 97%, ENSRNOG00000009152: 97%
Entrez Gene ID: 4076
Uniprot ID: Q14444
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CAPRIN1
Alternative Gene Name: caprin-1, GPIAP1, M11S1, RNG105
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027184: 97%, ENSRNOG00000009152: 97%
Entrez Gene ID: 4076
Uniprot ID: Q14444
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDM |
Documents & Links for Anti CAPRIN1 pAb (ATL-HPA063617 w/enhanced validation) | |
Datasheet | Anti CAPRIN1 pAb (ATL-HPA063617 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CAPRIN1 pAb (ATL-HPA063617 w/enhanced validation) at Atlas |
Documents & Links for Anti CAPRIN1 pAb (ATL-HPA063617 w/enhanced validation) | |
Datasheet | Anti CAPRIN1 pAb (ATL-HPA063617 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CAPRIN1 pAb (ATL-HPA063617 w/enhanced validation) |