Anti CAPNS2 pAb (ATL-HPA076768 w/enhanced validation)

Catalog No:
ATL-HPA076768-25
$447.00
Protein Description: calpain small subunit 2
Gene Name: CAPNS2
Alternative Gene Name: MGC12536, MGC14804
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078144: 86%, ENSRNOG00000045747: 55%
Entrez Gene ID: 84290
Uniprot ID: Q96L46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence KWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGD
Gene ID - Mouse ENSMUSG00000078144
Gene ID - Rat ENSMUSG00000078144
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti CAPNS2 pAb (ATL-HPA076768 w/enhanced validation)
Datasheet Anti CAPNS2 pAb (ATL-HPA076768 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAPNS2 pAb (ATL-HPA076768 w/enhanced validation) at Atlas

Documents & Links for Anti CAPNS2 pAb (ATL-HPA076768 w/enhanced validation)
Datasheet Anti CAPNS2 pAb (ATL-HPA076768 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAPNS2 pAb (ATL-HPA076768 w/enhanced validation)