Protein Description: calpain small subunit 2
Gene Name: CAPNS2
Alternative Gene Name: MGC12536, MGC14804
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078144: 86%, ENSRNOG00000045747: 55%
Entrez Gene ID: 84290
Uniprot ID: Q96L46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CAPNS2
Alternative Gene Name: MGC12536, MGC14804
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078144: 86%, ENSRNOG00000045747: 55%
Entrez Gene ID: 84290
Uniprot ID: Q96L46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGD |
| Documents & Links for Anti CAPNS2 pAb (ATL-HPA076768 w/enhanced validation) | |
| Datasheet | Anti CAPNS2 pAb (ATL-HPA076768 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CAPNS2 pAb (ATL-HPA076768 w/enhanced validation) at Atlas |
| Documents & Links for Anti CAPNS2 pAb (ATL-HPA076768 w/enhanced validation) | |
| Datasheet | Anti CAPNS2 pAb (ATL-HPA076768 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CAPNS2 pAb (ATL-HPA076768 w/enhanced validation) |